header image

Novel Strategies for Disrupting Cancer-Cell Functions with Mitochondri | IJN – Dove Medical Press

Introduction

Mitochondria are multifunctional organelles found in most eukaryotic cells that form a comprehensive intracellular network controlled by a proper balance among fusion, fission, biogenesis, and mitophagy.1,2 These organelles are acknowledged for storing and harvesting energy, released by oxidative phosphorylation. Mitochondria are maternally inherited organelles, and most of their proteins are nuclear-encoded. However, these organelles retain a small DNA genome of about 16 kb mitochondrial DNA (mtDNA), which encodes rRNAs and tRNAs and proteins required for respiration. Eukaryotic cells generally contain hundreds of mitochondria with their mtDNA either free of mutations (wild type), mutated mtDNA, or a mixed population known as heteroplasmy.3

These organelles are significant junctions for intracellular interactions with other organelles. They interact with nuclei, the endoplasmic reticulum (ER), and peroxisomes through membrane contact, vesicle transport, and signal transduction to regulate biosynthesis, energy metabolism, immunoresponse, and cell turnover. However, when this normal communication among mitochondria and other organelles fails or when mitochondria are dysfunctional, it most often induces different diseases and especially tumorigenesis.4 Mitochondrial diseases are well known to be devastating, and can affect many organs like muscles, the heart, and the nervous system. These diseases can either be of maternal inheritance or by nuclear inheritance of loss-of-function mutations in some essential mitochondrial genes.5

Most cancers retain mitochondrial functions, including respiration, and even some tumors show enhanced oxidative phosphorylation.6 The energy-harvesting functions of mitochondria are at least as important for cancer progression as ATP generation.7 Cancer cells survive easily during hypoxic milieus by recycling NADH to NAD+ through plasma-membrane electron transport and lactate dehydrogenase to continue glycolytic ATP synthesis.810 The precise role of mitochondria during different phases of cancer has been recently reviewed. This review discusses the altered functions of mitochondria during cancer, changes in mitochondrial dynamics, and targeting mitochondria with specific mitochondriophilic biomolecules at multiple sites during cancer progression. In addition, therapeutic strategies, including the use of novel NPs (NPs) conjugated with mitochondriophilic biomolecules, to combat cancer progression are discussed.

The fundamental role of mitochondria as eukaryotic cell organelles was verified over a century ago.11 During a healthy state, these organelles regulate some vital cellular functions through the tricarboxylic acid cycle (TCA), oxidative phosphorylation, fatty-acid oxidation, and calcium homeostasis. Mitochondria also regulate heme biosynthesis, ketogenesis, urea cycle, gluconeogenesis, and ironsulfur cluster formation.12 These organelles possess their own DNA (mtDNA), which controls some important functions and can get mutated or partially deleted. Mitochondria are enclosed by a lipid-bilayer double-membrane system inner mitochondrial membrane (IMM) and outer mitochondrial membrane (OMM) which are separated by intermembrane space. Much of the inner space of the mitochondrial matrix is occupied by cristae, which are formed by extensive IMM folds. Each mitochondrial component plays specific roles that controls many of the overall cellular activities.13

There are several proteins and enzymes that regulate mitochondrial function, fission, fusion, interaction, and cross talk with other organelles. Mitochondrial fission is promoted by mitochondrial fission 1 protein (FIS1) and mitochondrial fission factor (MFF) present in OMM. Mitochondrial fission controls important functions like autophagy, apoptosis, and cell death.14 On the other hand, mitochondrial fusion is achieved by the outer-membrane fusion proteins, Mfn1 and Mfn2 and the inner-membrane fusion protein OPAC1.15 Mitochondrial fusion controls mitochondrial membrane potential (MMP), cell growth, and electron-transport chain (ETC) functions.16

For the normal functioning of a cell, proper crosstalk between mitochondria and other organelles is very important. Any impairment in this connection may lead to alteration of the cellular environment, which can activate certain oncogenes and mitochondrial genome mutation.4 Precise control exists between the nucleus and mitochondria for the stability of these organelles. Any cross-talk dysfunction between these two organelles can lead to DNA damage in both, abnormal activation of growth factors, Ca2+ overload, and metabolic disorders, which are prominent hallmarks of cancer.17,18

An active and strong interaction exists between the ER and mitochondria for the coordination of important cellular biological functions like Ca2+ signaling, ER stress response, regulation of apoptosis, phospholipid biosynthesis, and translocation from the ER to mitochondria. In addition, proper interaction between mitochondria and peroxisomes is very important for reactive oxygen species (ROS) and lipid balance.

In addition to the regulation of biosynthetic precursor balance, energy production, and cytosolic Ca2+ levels, mitochondria can modulate redox status and ROS generation and initiate apoptosis through the activation of mtPTP.19 Mitochondria are the major sources of ROS (ie, hydroxyl radicals, hydrogen peroxide, and superoxide anions), and these reflect the imbalance between antioxidant defense and ROS production. The most pronounced ROS-depended damage includes vascular tonus impairment and platelet adhesion and alterations in gene transcription and metabolism.20 This usually occurs due to hydrogen peroxide, which besides acting as intracellular messenger, controls autophagy, senescence, and apoptosis.20 These processes are closely related to one another, the relationship appears rather complex, and the boundaries are difficult to delineate.

In some circumstances, autophagy can lead to cell death while apoptosis is inhibited, so acting as a backup mechanism for death progression.21 During some failure conditions, to activate autophagy as a cell-survival mechanism during nutrient starvation, it leads to cell death by apoptosis with the involvement of BAX/BAK proteins. These are BCL2-family proteins that are required for caspase activation or mitochondrial outer-membrane permeabilization,22 which is the point of no return in different forms of apoptotic cell death, as it initiates proapoptotic, enzyme-mediated proteolytic cascades and damages mitochondrial functions.23 The cross-regulation among autophagy, senescence, and apoptosis is a complex phenomenon and still far from being understood. The role played by mitochondria in the onset of these process is briefly discussed in many sections of this article.

Mitochondria may play a significant role in the development of cancer phenotypes through at least five mechanisms. First, it has been commonly demonstrated that DNA mutations affect mitochondria and lead to many diseases, mainly due to alterations in ETC subunits.24 Second, ROS are mainly produced from mitochondria (mtROS), which mediates oxidative stress (OS) and is the principal cause of cancer generation and progression.25 mtROS can be generated either in the ETC or during the TCA cycle.26 Enhanced levels of ROS are usually found in cancer cells, due to altered antioxidant potential.27 Third, the mitochondria have a direct role in cell-death regulation, including but not limited to necrosis and apoptosis.28 For the induction of apoptosis, BCL2 proteins interact with mitochondria through binding with voltage-dependent anion channels (VDACs) to enhance the release of cytochrome c (cyt c).29 Mitochondria also control necroptosis, which is a regulated form of necrosis that requires mitochondrial permeability transition and mtROS.30 Fourth, metabolic reprogramming also affects gene mutations encoding enzymes of the TCA cycle, which can promote cancer transformation.31 Fifth, telomerase reverse transcriptase shuttles from the nucleus to mitochondria during enhanced oxidative stress. It is used to preserve mitochondrial functions, decrease oxidative stress, and protect mtDNA and nuclear DNA from oxidative damage to avoid apoptosis.32

Though cancer cells are highly diverse, all display some stereotypical traits or hallmarks, and mitochondria play an important role in such hallmarks.33 Mitochondria play a significant role in initiation of cancer, which can be due to dysregulated signaling, mtDNA mutations, oxidative stress, metabolism, bioenergetics, fission and fusion dynamics, or biogenesis and turnover. The distorted bioenergetics within cancer cells help them meet the required energy demands by ATP generation through the ETC.

During acute myeloid leukemia (AML), altered mitochondrial metabolism occurs, due to mutations in isocitrate dehydrogenase (IDH). An isoform of IDH, IDH3 catalyses the formation of -ketoglutarate from isocitrate in the TCA cycle. In parallel, IDH1 and IDH2 catalyse the same reaction, but outside the TCA cycle.34 Aberrant mitochondrial metabolism during AML has opened the possibility of using several drug nanoformulations to rectify mutations. Various studies on in vivo and in vitro AML models have demonstrated the benefits of using mitochondria-targeted mitocans in combination therapies. In this regard, arsenic trioxide has been found to be a potential drug at the clinical level for acute promyelocytic leukemia patients. The use of arsenic trioxide has raised hopes of discovery in more aberrant mitochondriatargeted drug nanoformulations as a therapeutic strategy in treating AML.

The transformed mitochondrial metabolism supports the rapidly dividing cancer cells by providing building blocks. Mitochondria show good flexibility in supporting cancer-cell survival during adverse conditions, such as starvation and chemotherapy.9 Therefore, understanding the mechanisms of mitochondrial function during normal and cancerous states will be crucial to develop next-generation cancer therapeutics. Some altered mitochondrial functions during cancerous state are outlined in the following sections.

Recent experimental data on mitochondria have overturned the belief that cancer cells quench their bioenergetic and anabolic requirements predominantly through aerobic glycolysis. It is now well acknowledged that mitochondrial metabolism plays a crucial role in cancer development and progression. These organelles play an important role in different steps of oncogenesis and response to treatment.35 This is further supported by the findings that different cancer cells depend primarily on oxidative phosphorylation for promotion of their tumorigenic potential.6,36 These observations are supported further by analysis of glioma cells, which are rescued by pyruvate and lactate, oxidative substrates produced during low-glucose conditions.37 In parallel, it has been observed that in MCF7 cells, oxidative metabolism produces 80% of ATP and increased glucose consumption is not necessarily linked with increased glycolysis.38 Furthermore, it has been found that some drug-resistant tumor cells are subjected to mitochondrial oxidative phosphorylation for their survival. The treatment of these cells with ETC complex I inhibitors prolongs survival and tumor burden in murine xenograft models.39

Mitochondria are indispensable for tumor cells, as they provide the major share of energy and process metabolic intermediates. The TCA cycle provides some major metabolic intermediates and building blocks for anabolism. Krebs cycle constitutes an epicenter in cellular metabolism, as numerous substrates can feed into it. As such altered TCA-cycle regulation and its continued feedback with dysregulated oxidative phosphorylation is crucial for the progression of cancer.

Several types of human cancers show that TCA cycle enzymes are often dysregulated and frequently mutated. Some of the most vulnerable enzymes are isocitrate dehydrogenase, aconitate hydratase, succinate dehydrogenase (SDH), fumarate hydratase (FH), and the -ketodehydrogenase complex.40,41 In addition, some metabolites of the TCA cycle control mitochondrial chromatin modifications and post-translational modification in proteins. The role of Krebs cycle rewiring during hepatocellular carcinoma has been summarized by Todisco et al, as they found dysregulation of glutamine metabolism, citratepyruvate, and malateaspartate shuttles. A link has also been observed between the transcription factor NFBHIF1 and TCA cycle reprogramming.42

Significant alterations have been observed in the abundance of some enzymes linked with aerobic glycolysis and Krebs cycle in gliomata of IDH1-mutant types.43 Enzymes involved in the metabolism of lactate, glutamate, and -ketoglutarate are also significantly enhanced in such mutant gliomata. In addition, increased expression of SLC4AG, a bicarbonate transporter has been observed in such gliomata. This suggests a mechanisms that preventing the glycolysis mediated intracellular acidification is active in such cells. This special type of metabolic rewiring preserves the activity of TCA cycle in IDH1-mutant glioma types.43

Cancer cells display metabolic aberrations accompanied by accumulation of ROS, which is the main cause of biomolecular damage, and if it exceeds the limit leads to cell death.44 The ETC releases electrons that are captured by O2 to generate O2, which leads to the formation of ROS.45 These entities lead to DNA damage and bind with intracellular and surface receptors and signaling molecules. All these changes lead to angiogenesis, proliferation, and apoptosis, significant aspects of cancer progression.46,47 The extensive DNA damage by ROS can promote carcinogenesis and the malignant transformation of normal cells. Excessive production of ROS also leads to Cyt. c release and can trigger programmed cell death.48 Enhanced levels of ROS pose a severe threat to mitochondria and even cell viability.

Normal cells exhibits continued mitochondrial fission and fusion cycles to maintain proper function. Fission- and fusion-machinery proteins also regulate intrinsic apoptotic pathways.49 In cancer cells, the genes responsible for mitochondrial dynamics regulation are amplified and inhibition of DRP1, a fission promoting GTPase known to induce apoptosis.50 DRP1 knockout in pancreatic cancer cells has been witnessed with diminished oxygen consumption and minimal ATP production, which results in reduced growth.51 In comparison to normal cells, lung adenocarcinoma has been reported to express lower levels of Mfn2 and higher levels of DRP1. Different phases of the cell cycle are also controlled by DRP1 dysregulation, which helps to maintain cell proliferation. DRP1 also inhibits p53 and promotes progression of the cell cycle.52 DRP1 expression has been found to be in phase with cell-cycle gene expression in ovarian cancer cells, as 55% of these genes regulate mitotic transition.53 Forced inhibition of DRP1 in these cells causes replication stress and delayed G2M transition. This replication stress leads to hyperfused mitochondrial structures and improper cyclin E expression during the G2 phase.54 In addition to this, silencing of DRP1 in breast cancer cells leads to suppressed metastatic abilities.55 Furthermore, inhibition of upregulated expression of DRP1 in hypoxic glioblastoma U251 cells attenuates hypoxia-induced mitochondrial migration and fission. All these findings support the view that DRP1 can be a potential therapeutic target in cancer cells.56 In addition, proteasomal degradation of Mfn2 induced by chemotherapy leads to mitochondrial fragmentation, which results in apoptotic cell death.57,58

In addition to mitochondrial aberrations in different cancers, high levels of mtDNA mutations have been reported in several cases.59 The different mtDNA mutations in diverse cancers include deletion, inversion, point mutation, and variation in copy number. These mutations potentially arise from the clonal expansion of cells containing mtDNA mutations. mtDNA mutations have been reported in a large percentage of lung cancer, colorectal cancer, head and neck cancer, pancreatic cancer, urinary bladder cancer, ovarian carcinoma, gastric cancer, breast cancer, and several other tumors.6066 Whether the enhanced frequency of mutated mtDNA in cancer cells is an outcome of their uncontrolled division or whether mtDNA mutations provide a selective advantage to these transformed cells that contributes to cancer initiation and progression remains an important open question.67

Some recent discoveries have shown intergenomic cross talk between mitochondria and the nucleus and the role of mtDNA variation in disturbing this signaling and thus indirectly targeting nuclear genes involved in tumerogenic and invasive phenotypes. Therefore, mitochondrial dysregulation is currently regarded as an important hallmark of carcinogenesis and a promising target for antitumor therapy.68 Moreover, the advancement of mtDNA editing tools is expected to improve strategies to characterize, track, and repair oncogenic mitochondria, which will further boost the understanding of mitochondrial epigenetics in cancer and therapeutic strategies.

Heme (protoporphyrin IX), an iron-containing molecule, is synthesized by human cells at the basal level.69 Heme plays a significant role in mitochondrial respiratory-chain complexes and different enzymes and proteins involved in oxygen metabolism like cytochromes, peroxidase, and catalase. Different types of cancers have been reported with elevated heme levels, and this elevation may contribute to the maintenance and proliferation of cancer.70 Oxygen consumption and heme biosynthesis are significantly intensified in lung cancer cells. In addition, protein levels in heme synthesis and uptake are increased in lung cancer. It has been found that the inhibition of heme and mitochondrial functions suppresses the cancer-cell proliferation and migration.70,71 Furthermore, some epidemiological studies have suggested that increased heme intake via red meat is associated with greater risks of breast, lung, pancreatic, oesophageal, and colorectal cancer. A study based on almost 500,000 individuals revealed that the consumption of processed meat leads to a 16% increased risk of lung cancer. Important sites of altered mitochondrial metabolism in cancer as potential targets for therapy are shown in Figure 1.

Figure 1 Some important locations of mitochondria that can be potential targets of anticancer-drug nanoformulations. (A) Mitochondria in normal and in cancer cells. (B) Highly metabolically active or hypoxic cancer cells generate superoxide (O2), which is immediately dismutated to H2O2. (C) in cancer cells, the TCA cycle produces reducing equivalents to fuel the ETC (green arrows), and also generates intermediates necessary for cell proliferation (red arrows). The most important anaplerotic reaction produces oxaloacetate directly from pyruvate (purple arrow). (D) Mitochondrial DNA (mtDNA) variations, including single-nucleotide polymorphisms (SNPs), maternally inherited haplotypes, and deletions, have been studied for their associations with cancer.

Novel anticancer drugs have been synthesized that can selectively disrupt cancerous mitochondria at different function targets by inhibiting glycolysis, disrupting the ETC and oxidative phosphorylation and depolarizing membrane potential. Here, we elucidate different locations of mitochondria in cancerous cells that can be novel targets to hit these types of cells.

Appropriate functioning of the ETC is very important to support oxidative phosphorylation and ATP synthesis, essential for tumorigenesis. Several ETC inhibitors like tamoxifen, -tocopheryl succinate, metformin, and 3-bromopyruvate have been used to disrupt the proper functioning of ETC respiratory complexes. These inhibitors lead to the induction of enhanced ROS generation and ultimately kill some cancerous cells.72 Proper use of these drugs specific to mitochondria of cancerous cells is a novel approach of drug targeting and requires deeper investigations for future cancer therapy.

Some novel mitochondria-targeted therapeutic agents like MitoTam, a derivative of tamoxifen, have been found to inhibit ETC complex I and lead to increased ROS synthesis. This drug has been used in breast cancer cells to induce their death.73 In parallel, another mitochondria-specific drug MitoVes, an analogue of vitamin E succinate inhibits ETC complex II and minimizes tumor growth by triggering apoptotic cell death in colorectal, breast, and lung cancers.74 In addition, several signaling pathways and ETC complex I have been targeted by ME44, which induces cell death by interfering with mitochondrial permeability in colorectal cancer.75 Mitochondria were further targeted by ME143 and ME344, which significantly inhibit oxidation of NADH by complex I, thus preventing electron flux through other oxidative phosphorylation complexes. ROS are generated by ME344-mediated inhibition of complex I, thus leading to BAX translocation to the OMM. This translocation leads to mitochondrial permeability transition, which results in the discharge of proapoptotic molecules.76

As the TCA cycle is the bioenergetic hub of metabolism and redox-state balance, it also serves as an important location of biosynthesis of different compounds. This hub is considered a novel location for different therapeutic strategies for the prevention of cancer. It involves mutations of isocitrate dehydrogenase genes, which have been reported in cancers like AML and glioblastoma.41,77 Novel therapeutic agents against these mutated gene products are now being engineered for the treatment of AML and other cancers.78 Some mutations have also been reported in FH and SDH in association with certain cancers, and any loss of these enzymes increases the vulnerability of a cancerous cell to a therapeutic agent.79 In addition to TCA cycle enzymes, oncogenes like HIF, MYC, RAS, and P53 are known to regulate the metabolic phenotype of tumor cells.80 As such, these additional pathways are now being explored as new therapeutic targets against cancer cells.81

Many cancer cells use glutamine as a fuel to supply essential nutrients and precursors for their constant growth. Inhibition of glutaminolysis can be an innovative therapeutic strategy for the treatment of various cancers. Some glutamine analogues (azaserine and 6-diazo-5-oxo-l-norleucine, azotomycin) have been tried as a treatment strategy, but this therapeutic protocol was not continued, as these analogues induced severe toxicity.82 These analogues can be tried again if transported specifically to cancer cells through mitochondria-targeted NPs.

Mitochondrial dynamics include morphology, distribution, fusion, and fission, which regulate different biological activities within the cell, including energy production. Most cancers show a prominent hallmark of increased fission compared to its fusion ratio.83 Some studies have targeted DRP1 with mitochondrial division inhibitor 1, a mitochondrial fission protein inhibitor, to reduce the tumorigenic activities of cancer stem cells.84 In parallel, an effective therapeutic strategy has been devised by using miR125a to inhibit Mfn2, which augments the mitochondrial fission in pancreatic tumor cells.85 The cell cycle is regulated by LATS2, which senses DNA-damage response. Overexpression of this gene activates mitochondrial fission and promotes mitochondrial stress in lung cancer cells, leading to their apoptosis. Targeting of LATS2 and its associated signaling can be an efficient therapeutic approach.86 The regulation of mitochondrial morphology through mitofusins and DRP1 is also regulated by E3 ubiquitin ligase (MARCH5). This protein is associated with breast cancer, and could serve as a potential therapeutic target.87

Cancer therapy can also be shortlisted by focusing on mitochondrial membrane transport mechanisms and associated proteins. This includes translocase of inner mitochondrial membrane 50 (TIMM50), involved in ERKP90RSK signaling-pathway regulation. It prevents E-cadherin expression, which promotes cancer proliferation in NSCLC cells, so can be an efficient therapeutic target in such cells.88 Furthermore, mitochondria-mediated apoptosis is also regulated by VDAC1, which is found at the OMM. Specific targeting of this complex may serve as a novel therapeutic approach for cancer treatment.89 Some important examples of mitochondria-specific antitumor drugs (mitocans) and treatment strategies with these are listed in Table 1.

Table 1 Mitochondrial function target sites for different mitocans and their possible treatment effects

A number of mitochondria-specific targeting ligands have been discovered that have tremendously improved therapeutic efficacy and greatly reduced the side effects of conjugated drugs. The direct targeting of these moieties to mitochondria has resulted in rapid response to the attached drugs.109 The most widely used mitochondria-targeting ligands are triphenylphosphonium (TPP), dequalinium (DQA), short peptide, rhodamine 19, and rhodamine 123, pyridinium, guanidine, (E)-4-(1H-indol-3-ylvinyl)-N-methylpyridinium iodide (F16), and 2,3-dimethylbenzothiazolium iodide. The direct conjugation of these mitochondria-specific moieties with anticancer drugs, sensors, and antioxidants by different bonds and spacers has resulted in enhanced cytotoxicity, sensing activity, and antioxidizing activity, respectively.110 Transformed and cancer-cell mitochondria display amplified transmembrane potential compared to normal cells.111 This difference has been utilized to develop mitochondria-targeting moieties that preferentially accumulate within cancer-cell mitochondria. Most mitochondria-targeting moieties are delocalized lipophilic cations, and their chemical structure is shown in Figure 2. They are also elaborated upon below in the following sections.

Figure 2 Chemical structure of some important mitochondria-targeted lipophilic cations.

TPP is a delocalized cationic lipid that readily penetrates through the mitochondrial membrane because of highly negative membrane potential. TPP is a well-known mitochondria-orienting moiety with cationic phosphorus bonded with three hydrophobic phenyl groups.112 This compound has been used significantly by conjugating with anticancer drugs like doxorubicin, porphyrin, coumarin, and chlorambucil to enhance mitochondria targeting within cancer cells.113 Accumulation of TPP is directly proportional to the negative charge of the mitochondrial membrane, and for every 60 mV negative membrane potential, TPP accumulation is increased by one order of magnitude. It has been reported that MMP is 180 mV, which can facilitate up to 1,000-fold buildup of TPP inside mitochondria.114 TPP has also been conjugated with chlorambucil (DNA-damaging anticancer agent) and used against breast cancer cell lines, resulting in an almost 12-fold reduction in IC50 compared to free drug.115 In a parallel study, vitamin E succinate has been conjugated with TPP, and this conjugate (MitoVES) presented enhanced mitochondrial accumulation.74

1,1-Decamethylene-bis-(4-aminoquinaldinium chloride) also named dequalinium (DQA) is a well-known lipophilic dication composed of two quinolinium moieties bonded with each other through an alkyl chain of ten carbons. This compound displays antiproliferative potential against different in vitro cancer cell lines and also shows in vivo antitumor properties.116 In aqueous medium, DQA molecules (single-chain bola-amphiphile) self-assemble and form vesicles known as DQAsomes.117 These vesicles are used to deliver pDNA within the mitochondria without any off-target leakage.118 In another study, DQA-conjugated, peptide-conjugated, and F16-conjugated anticancer drugs were used against different cancers.119

Mitochondria-penetrating peptides (MPPs) have repeating lipophilic and cationic residues, eg, (L-cyclohexyl alanine-D-arginine)3 (Figure 2). These peptides show mitochondrial buildup with low toxicity against human tumor cells.120 Doxorubicin has been conjugated with MPP via succinate linkage. Another examples of mitochondria-specific peptides is SzetoSchiller (SS) peptides. These tetrapeptides denote a special class of novel chemical entities that precisely target mitochondrial cardiolipin, improve the plasticity of mitochondria, and recondition bioenergetics. They are water-miscible tetrapeptides composed of Tyr-dimethyltyrosine (Dmt)-Arg-Phe-Lys residues. These peptides get selectively built up within the IMM and scavenge ROS. Further, these peptides block the opening of mitochondrial permeability transition pores, thus stopping the release of cytochrome c (cyt c).121 Different types of SS peptides have been engineered (SS1S31), and SS01 (Tyr-D-Arg-Phe-Lys-NH2) is shown in Figure 2.

The smart character of SS peptides lies in their mutual lipophilicity and positive charge, which is essential for easy passage through the cell membrane and mitochondrial membranes. To target mitochondria more specifically, a key strategy is to ensure alternate basic and aromatic amino residues. This approach has been used to design SS31 (D-Arg-Dmt-Lys-Phe-NH2), an efficient ROS scavenger through inhibiting lipid peroxidation. The safety and efficacy of SS31 led to a phase II clinical trial on microvascular and ischemiareperfusion injuries, in patients with acute myocardial infarction. This trial also involved the treatment of hypertension-mediated renal microvascular dysfunction and kidney injuries. This drug has also been used for the treatment of diabetic macular edema and heart failure.122

In addition, an amphipathic molecule, -helical D-(KLAKLAK)2, has been used for targeting the IMM, as this drug has improved anticancer potency.123 Keeping the chemistry of these drugs in mind in terms of their alternate hydrophobic and cationic nature, it has attracted to design similar MPPs. This led to the design of P11LRR, an arginine-modified amphiphilic peptide that comprises polyproline scaffolds and has a helical structure. It has been reported that accumulation of P11LRR within mitochondria is basically driven by its transmembrane potential. Its mitochondria-targeting impact is further enhanced by the amphipathic -helical structure, as this is crucial for the import of some peptide sequences up to mitochondria.124

Guanidinium and bigaunidinium moieties possess delocalized positive charges, and have been conjugated with hydrophobic porphyrins as photosensitizers and phototoxic agents to enhance mitochondrial accumulation. Guanidine and biguanidines have been reported to possess enhanced lipophilicity. These amphiphilic porphyrins have been bonded with different moieties to enhanced mitochondria targeting. These conjugates have been found to possess high membrane potential across the IMM and have been used for the treatment of cancer.125 Cellular uptake of these conjugates and their subcellular localization studies have revealed that guanidine-porphyrins are readily engulfed by cells and get accumulated in mitochondria more quickly than bigaunidine moieties. These conjugates possess enhanced mitochondria targeting and improved phototoxicity against certain cancer cells. The guanidine-porphyrin conjugates represent 1.8 fold enhanced phototoxicity than biguanidineporphyrins.126 The presence of guanidinium shows a proton-sponge effect within lysosomes and promotes lysosomal membrane rupture and escape capacity, even when conjugated with porphyrins. Metformin is a good example of biguanide, which acts as an antihyperglycemic agent and suppresses mitochondrial respiration, as it inhibits respiratory complex I.127

(E)-4-(1H-Indol-3-ylvinyl)-N-methylpyridinium iodide (F16) is a delocalized cation that accumulates within the mitochondrial matrix. The accumulation of this cation within this organelle lies in its higher MMP (m) capability. This accumulation also causes depolarization of the membrane, disrupting the integrity of mitochondria, and opens mitochondrial permeability transition pores. These events lead to cytochrome c (cyt c) release, cell arrest, and ultimately cell death.128 The antiproliferative potential of F16 has been reported in a variety of human breast cancer cell lines and mouse mammary tumors.

Unlike other apoptosis inducers, F16 acts in mitochondria at the junction of the apoptotic and necrotic pathways. This compound results in the induction of permeability transition and changes the functional integrity essential for cell survival. It has been observed that cell death in F16-treated overexpressing BCL2 clones is prevented under conditions of higher concentration of ATP maintenance to neutralize superoxide anions. This indicates that overexpressing BCL2 cells show necrotic death that coincides with F16-mediated mitochondrial dysregulation.129

Rhodamine has a mitochondria-targeting nature due to its lipophilic and cationic properties. These properties are the basis of crossing the double mitochondrial membrane ands accumulation within the negatively charged mitochondrial matrix.130,131 Rhodamine is also efficient at mitochondria targeting and damaging the ETC when bound to mitochondria. Both rhodamine 19 and rhodamine 123 have potential in targeting mitochondria.132 The mitochondria-targeting capacity of rhodamine 19 has been confirmed by substituting TPP. In brief, rhodamine 19 is a potential mitochondria-targeting cationic uncoupler, and shows its protonophorous uncoupling potential and maintains equilibration across the mitochondrial membranes in a Nernstian style. Some examples of important mitochondria-targeting moieties liganded with different drugs through specific bonds or spacers and their respective responses are listed in Table 2.

Table 2 Mitochondria-targeting moieties conjugated with various drugs through a specific bond or spacer, provoking different reactions and mediating important changes

In clinical practice, the use of single-unit nanoformulations in therapeutics and diagnostics (theranostics) is a novel approach to drug delivery.145 Theranostic NPs exhibit several advantages over the conventional systemic administration of native drugs. These include overcoming the problems of limited solubility, inactivation, biodegradation, and minimal off-target toxicity. Other benefits include extended circulation time, higher concentration at tumor site, multiple synergistic drugs, diagnostic system delivery,146 controlled drug release at tumor sites through stimulus-sensitive delivery systems, eg, pH, temperature, enzyme-sensitive nanoformulation, overcoming multidrug resistance and enhanced therapeutic efficacy. The approach of this drug-delivery system even up to the organelle level (third-level drug targeting) with the aid of different nanoformulations has revolutionized the therapeutic approach to different diseases, including cancer.

Mitochondria-related diseases can be best addressed by the novel strategy of using nanoformulations, which can also prove to be a valuable tool to overcome the current limitations of treating mitochondrial diseases. These nanoformulations can be powerful targeted drug-delivery systems to mitochondria.147 Moreover, they can drastically improve the pharmacokinetic and biodistribution properties of various therapeutic drugs. The uptake of NPs loaded with chemotherapeutic agents by mitochondria stimulates ROS generation and Cyt. c release, sequentially activates the downregulation of caspase 3/9 precursors, and ultimately induces mitochondrial permeability. These responses result in mitochondrial edema and cause substantial damage. Moreover, NPs dysregulate membrane potential and promote mitochondrial death pathways, inducing the elevation of apoptotic events within cancer cells.148

Delivery systems based on NPs must be meticulously designed with proper size, shape, charge, lipophilic surface, and specific density to achieve center-point targeting within mitochondrial locations. NPs need to have spatiotemporal control over the release of their drug payloads at different mitochondrial compartments.149 NP size impacts drastically on cellular uptake by influencing adhesion strength with cellular receptors. Optimal cellular uptake with ligand-coated NPs has been found to be met at almost 50 nm diameter.150 Similarly, the highest uptake of spherical mesoporous silica NPs by HeLa cells is at 50 nm.151 In addition, targeted AuNPs have been reported to possess the highest cellular uptake by SKBR3 cells at 4050 nm in size.152 Currently, NPs/nanoformulations are conjugated with different mitochondria-specific compounds to achieve best organelle targeting. Some common examples of NPs used against mitochondria of different cancer cell lines are presented in Figure 3.

Figure 3 (A) Schematic representation of mitochondria-targeted nanoformulations loaded with hydrophilic and hydrophobic drugs. These NPs can also be loaded with Mitochondria-targeted genes. (B) Approaches for drug-loaded NP entry within a target cell. (C) of Mito-Porter approach for targeting of cancer-cell mitochondria. (D) Membrane fusion of Mito-Porter with OMM and IMM and the delivery of mitochondria-specific drugs and genes.

Liposomes are spherical vesicles composed of one or more concentric lipid bilayers and are routinely used as drug-delivery vehicles. The physicochemical properties of these vesicles differ considerably on size, composition, surface charge, and even method of preparation.153 New modifications of conventional liposomes to achieve efficient mitochondria targeting are ongoing, as these entities need to be cheaper, atoxic, and biodegradable. This has led to the formation of TPP-modified liposomes coloaded with a photothermal near-infrared (NIR) imaging agent, IR780 iodide, and a photosensitizer known as chlorin e6. These novel liposomes show enhanced toxicity to HeLa cells and some tumor vessels in vitro compared to untargeted ones. In addition, this technique has led to easy and controlled release of drugs and imaging agents to achieve antitumor angiogenesis and photothermal therapy.154 In a parallel strategy, stearyl residues have been conjugated with TPP and incorporated as STPP within lipid bilayers.155 These STPP-modified liposomes were further loaded with ceramide, which showed significantly reduced tumor volume in BALB/c mice.

Liposome-based drug formulations face some aggregation and instability issues in blood. This complication has been resolved by using hybrid cerasomes based on the SiOSi framework and liposomes.156 The cerasomes were conjugated with TPP using 3-aminopropyl triethoxysilane, which acts as a linker. These TPP-modified cerasomes were loaded with doxorubicin (TPPCERDox) through self-assembly process and formed phospholipid bilayer vesicles covering the cerasomes. These possessed extraordinary stability, biocompatibility, sustained drug release, and efficient drug accumulation within mitochondria.157

Recently, a novel liposome (Mito-Porter) has been designed with phosphatidic acid or sphingomyelin nd its surface modified with octaarginine (R8) and GALA, a membrane fusogenic peptide. This special type of liposome can introduce specific cargoes into mitochondria using the advantage of membrane fusion. The presence of highly dense R8 enables the liposomes to achieve micropinocytosis-mediated cell-membrane internalization. The presence of GALA helps the liposomes escape endosome formation. Mito-Porter helps to fuse successfully with both the OMM and IMM158,159 (Figure 3).

Mito-Porters have also been designed for targeting nucleic acids specific to the mitochondrial genome. The presence of phosphatidic acid or sphingomyelin in this formulation facilitates enhanced mitochondrial membrane binding and special cargoes are released within the mitochondrial compartment. For intracellular trafficking of Mito-Porter, R8 plays a crucial role, as its higher density leads to internalization by micropinocytosis and its lower-density vehicles being taken up by clathrin-mediated endocytosis and degraded by lysosomes.158,160

Mito-Porters have also been used to transport fluorescent dyes like propidium iodide for staining nuclear DNA.161 Advancement in the same study led to the discovery of a dual-function Mito-Porter system that penetrates the endosomal and mitochondrial membranes by phase-wise membrane fusion.162 A study was based on comparison of the effective dose for the two types of nanocarriers, and the results showed that the dual-function Mito-Porter was 15-fold higher in efficiency than conventional Mito-Porter for mitochondrial delivery.163

Furthermore, instead of R8, mitochondrial signal targeting signal peptide (MTS) with sequence NH2-MVSGSSGLAAARLLSRTFLLQQNGIRHGSYC was used to form MTS-Mito-Porter; however, this system showed labile aggregation, eventhough it was highly efficient for mitochondrial delivery compared to R8-Mito-Porter.164 In further research, S2 peptides modified with stearyl-Dmt-D-Arg-FK-Dmt-DArg-FK-NH2 were used to decorate the dual-function Mito-Porter, which provoked lower toxicity than the DF-R8-Mito-Porter.165 The mechanism of Mito-Porter uptake by cells and its fusion with mitochondria for the delivery of loaded drug is illustrated in Figure 3.

DQAsomes are well known mitochondriotropic bola-lipidbased vesicles composed of dequalinium (DQA;1,1-decamethylene-bis-[4-aminoquinaldinium chloride]), a dicationic amphiphilic molecule. These vesicles were designed for the transportation of drugs and DNA specific for mitochondria.166 Studies have now demonstrated that DQAsomes induce necrotic and apoptotic activities, as these nanovehicles induce mitochondrial dysregulation. DQAsomes cause mitochondrial membranepotential reduction, excess ROS production, ATP depletion, activation of the protein kinasesignaling cascade, and induction of apoptosis by mitochondria-dependent pathways.167

A novel formulation of curcumin encapsulated by DQAsomes has been prepared with average hydrodynamic diameter about 185 nm, drug-loading capacity up to 61%, and encapsulation capacity up to 90%. These DQAsomes possessed enhanced antioxidant activity compared to free curcumin. These vesicles are potential mitochondria-targeting vehicles, thus representing a promising formulation and improved stability for mitochondria-targeting strategies.168

Some specifically modified DQAsomes have been engineered to deliver plasmid DNA to mitochondria as DQAplexes, a hybrid of DNA and DQAsomes.169 (Figure 3). The application of DQAsomes has been extended further to deliver mitochondria-specific chemotherapeutic drugs. This includes the use of the anticancer drug paclitaxel, which induces apoptosis and ultimately cell death.170 This technique has revolutionized mitochondrial gene-therapy protocols, as the preparation of DQAsomeDNA complexes is quite efficient and simple.169 Plasmid DNA is first coupled with mitochondrial homing sequences for mitochondrial delivery only.171 It has been reported that after harvested mitochondrial contact with DQAplexes, DNA gets released quickly and escapes endosomes.172

Polymeric NPs are formed from poly(glycolic acid), polylactic acid, polycaprolactone, or polylactic-co-glycolic acid (PLGA). These NPs are efficient biocompatible and biodegradable polymers and promising drug carriers.173 They can encapsulate both hydrophilic and hydrophobic drugs.173 A special type of polymeric NP prepared from polycaprolactone modified with PEG and TPP and self-assembled into micelles with a diameter 3860 nm showed CoQ10-loading efficiency of almost 9.5%. These micelles were efficiently loaded and accumulated in mitochondria.

In another study, TPP-modified PLGA-PEG and PLGA-COOH NPs were prepared and their size, potential, and stability optimized. Those with diameter <100 nm and potential >22 mV were efficiently taken up by mitochondria. For clinical application, they were loaded with four drugs: 2,4-dinitrophenol (mitochondrial decoupler), curcumin (amyloid- protein inhibitor for Alzheimers disease), -tocopheryl succinate (tumor targeting drug), and lodamine (mitochondrial glycolysis inhibitor).174 These NPs improved the therapeutic activity of 2,4-dinitrophenol and decreased the amyloid-mediated cytotoxicity.175

In other research, thioketal linker-modified camptothecin (Cpt) was conjugated with PEGylated TPP to form (TL-Cpt-PEG1K-TPP) and blended with DSPEPEG-NH2. This led to the synthesis of photodynamic and chemosensitive dual-function NPs loaded with the photosensitizer molecule as zinc phthalocyanine (ZnPc). These nanoformulations were irradiated by 633 nm laser to produce ROS by thioketal linker rupture, thus releasing Cpt. This led to increased antitumor efficiency against lung cancer. This demonstrates that TL-Cpt-PEG1K-TPP guided the development of mitochondria-targeting in malignant cells with sixfold the cytotoxic activity of free ZnPc and Cpt in NCI-H460 cells.176

Another study used chitosan NPs functionalized with TPP and loaded with Dox. These NPs showed increased antitumor efficiency in A549 and HeLa cells.177 In parallel, PEG-TPP was linked with a disulfide bond. This polymer self-assembled and led to the formation of a hydrophobic TPP core and a hydrophilic PEG shell. Dox was loaded within these NPs and endocytosed by specific cells. Within the cells, glutathione broke the disulfide bond between mPEG and TPP, so removing the mPEG shell, exposing TPP, and driving Dox directly to mitochondria. These results further demonstrated that Dox-encapsulated mPEG-TPP NPs possessed enhanced mitochondria-targeting efficacy and improved therapeutic activity compared to other nonbioreducible NPs.178

The new investigational drugs for the treatment of an increasing number of hematological cancers still have a poor record. Healthcare professionals and researchers are working intensively to find an effective therapy against chronic lymphocytic leukemia.179 Currently, personalized and targeted therapies with active compounds in nanoformulations capable of center-point targeting of cancer cells are the most favorable trends in oncology.180 To date, among the different studies on NPs, dendrimers have demonstrated strong potential in pharmacological applications, and look to become a milestone achievement in oncology and nanomedicine.181,182

Dendrimers are synthetic, hyperbranched macromolecules possessing three components, ie, a central core, repeated branches, and a surface with a controlled number of available groups to load multiple functionalities. The core and branched space is used for biomolecular entrapment, and surface functionality is used to integrate different moieties. These special properties brand dendrimers as multipurpose pharmaceutical nanocarriers.183 They have potential in biomedical applications, and are used as drug carriers184 and gene-transfection vectors,185 as well as in magnetic resonance imaging (MRI) detection.186 The nanometric size of these NPs facilitates their specific and effective interaction with cellular components like proteins, nucleic acids, membranes, and organelles.187 Dendrimers with a generation number greater than five and higher positive charges due to lipophilic cationic molecules like TPP and rhodamine can be engineered. These NPs have the potential for endosomal escape and can deliver chemotherapeutic drugs directly to mitochondria.

Some of the most widely used dendrimers include polypropyleneimine (PPI) and polyamidoamine (PAMAM). These dendrimers are toxic, owing to their positively charged surfaces.188 Proper surface modification is the best way to minimize their toxicity. PPI dendrimers have been modified with maltose and maltotriose sugar residues, and these semi-modified open-shell (OS) PPI dendrimers (PPI-G4-OS) are lethal to selected cancer cells like CEM-SS, MEC1, and U87.189 In comparison to this, their fully modified dense-shell (DS) counterparts (PPI-G4-DS) show relatively weaker or no such effects. Furthermore, neutral DS and cationic OS PPI glycodendrimers have been utilized as stabilization and transfection agents for different particles.190 Third-generation cationic PPI glycodendrimers with open maltotriose shells (PPI-Mal-IIIG3) have been used for the transfection of AuNP conjugated with turbo green fluorescent protein (mitoTGFP) against selective mitochondria targeting of JIMT1 cancer cells. This facilitation of AuNPs by PPI dendrimers led to mitochondrial rupture, triggering apoptosis.191

PAMAM dendrimers are significantly used as a platform for the delivery of genomic materials and drugs.192 PAMAM-based G(5)-D-Ac-TPP dendrimers have been designed for mitochondria targeting in drug delivery.193 For monitoring intracellular localization, these NPs are labeled with a fluorescent dye, and less cytotoxicity has been reported with these nanocarriers. A parallel strategy has been used to deliver the luciferase gene and EGFP within the COS7 and HeLa cells by utilizing TPP-conjugated PAMAM dendrimers (G5-TPP).194 Under the transfection condition, these dendrimers have been reported to be atoxic. The G5-TPP dendrimer platform demonstrates efficient DNA packing and unpacking, endosomal escape, and efficient Mitochondria-targeting genome and drug delivery.

Multiwalled carbon nanotubes (MWCNTs) have been used as anticancer delivery vehicles by surface functionalization with mitochondria-specific ligands. A novel mitochondria-targeted peptide sequence (MTS) with a primary structure of KMSVLTPLLLRGLTGSARRLPVPRAKC has been tagged on MWCNT surfaces to attain efficient mitochondria-specific drug delivery. With the help of confocal microscopy, these nanocarriers have been found to accumulate extensively in HeLa cells and macrophage mitochondria. Mitochondria targeting of these NPs has been further confirmed by transmission electron microscopy (TEM). Further, these NPs have not been reported to possess any significant toxicity, so are potential candidates as effective mitochondria-targeted drug-delivery systems.195 In this vista, mitochondrial-targeting has also been achieved by cationic rhodamine- 110 (MWCNT-) and fluorescein (MWCNT-Fluo) used as an untargeted control.196 MWCNT- has also been used to entrap a platinum prodrug (PtBz), which presented enhanced potency and efficient mitochondrial localization.

Inorganic NPs cover a broad range of substances, including elemental metals, metal oxides, and metal salts. Inorganic NPs have been utilized as mitochondria-targeting agents, as these form uniform and smaller NPs. Among these, hydroxyapatite (HAp; Ca10(PO4)6(OH)2), displays outstanding drug-loading capacity and biocompatibility. It has been reported that HApNPs enter tumor-cell mitochondria and induce apoptosis by disturbing MMP, causing leakage of cytochrome c (cyt c).197 Rod-shaped HApNPs have been engineered with about 50 nm length and almost 10 nm width, and are engulfed by caveolate-mediated endocytosis by normal bronchial epithelial cells (16HBE) and lung cancer cells (A549). Interestingly, it has been further reported that A549 lung cancer cells engulf more NPs, causing sustained rise in Ca2+ concentration compared to 16HBE normal cells. This property of specific cell and mitochondria targeting causes increased Ca2+ concentration, resulted in almost 40% cancer-growth inhibition even without a drug, in lung cancer in nude mice.198 Anticancer efficacy was furthered with Dox-loaded HApNPs and coating with hyaluronic acid (HA). This nanoformulation specifically targets CD44-overexpressing cancer cells and overcomes the burst drug release. It has been found that Dox-loaded HAp-HA NPs exhibit almost four- to sevenfold the cytochrome c (cyt c) release of free Dox under similar conditions.199

Metallic NPs are emerging as innovative drug carriers and contrast agents for the treatment of different cancers. Metallic NPs are routinely used as site-specific targeting, drug delivery, and imaging of different tumor cells.200 Metal and metal oxide NPs can be precisely synthesized and modified with different functional groups. The novel functionalization of these metallic NPs helps in conjugating them with various mitochondria-specific moieties for use in specific cancer treatment. Some common metallic NPs are explained in the following sections to understand their significance for mitochondria targeting and cancer management.

In addition to other metallic NPs, gold NPs (AuNPs) have been demonstrated to accumulate within mitochondria and trigger apoptosis after internalization by cells.201 AuNPs have been conjugated with GFP and tagged at the amino terminus with a mitochondrial localization sequence of the IMM protein COX8. To overcome the aggregation of AuNPs, these nanoformulations were altered with cationic maltotrioseamended polypropyleneimine dendrimers to coat mitTGFP-AuNPs. However, for proper transfection, this nanoformulation (mitoTGFP-AuNPs) required a cationic glycodendrimer (PPI-Mal-III G3) for traversing the plasma membrane. These NPs quite successfully escaped early endosome formation, efficiently ruptured the OMM, and finally got localized within the IMM. This resulted in cytochrome c (cyt c) release that triggered apoptosis.202 In a similar fashion, multilayered polypeptides were used to surround the AuNPs. The first layer used was a CALNN-based peptide to avoid the aggregation of AuNPs. The second layer was tetrameric streptavidin, a linker to join biotinylated molecules. The outermost layer was a biotinylated peptide (KLA:(KLAKLA)2), which possessed both the mitochondriotropic agent and cytotoxic peptide to kill the cancer cells. These KLA-tagged AuNPs possessed thousands of times the antitumor activity of free KLA peptide. KLA peptide is well recognized for its efficiency in cell entry and mitochondrial specificity.203

TiO2NPs have stronger catalytic activity and have been widely used for different applications.204 These raise some concerns about adverse health effects, as they are smaller particles with larger surface area.205 Significant associations have been found between metabolic stress, inflammatory response, and ROS production and treatment with TiO2NPs in brains of mice.206

TiO2NPs can concentrate in the brain after crossing the BBB, thereby resulting in infiltration of inflammatory cells and apoptosis of hippocampus cells. This leads to a decrease in cognitive brain functioning.207 ROS generation damages the cell membrane, which further facilitates the entry of TiO2NPs, activating signaling pathways involved in oxidative stress. To check oxidative stress, expression ofNRF2 is very important. The association between oxidative stress and p38, JNK, and MAPK cascade is well established.206 In addition to this, TiO2NPs induce apoptosis, alter the immune system, and works as a secondary messenger for some intracellular signaling cascades. TiO2NP-mediated enhanced ROS production may also be related to p38NRF2 signaling pathways during brain injury.208

Silver NPs (AgNPs) have been widely used in chemical, antimicrobial, household, and medical applications.209 AgNP composition, size, shape, charge, and solubility affect their ability to bind with biological sites. The cytotoxicity of AgNPs is mainly related to cell-membrane destruction, which leads to mitochondrial destruction.210 These NPs usually induce oxidative stress, which is the major reason for their toxicity.211 AgNPs also deplete the antioxidant defense system, leading to enhanced ROS accumulation, which initiates the inflammatory response, and the destruction of mitochondria.212,213 The perturbation of mitochondria also leads to cytochrome c (cyt c) release and apoptosis as the final outcome. AgNPs also exhibit toxicity toward mammalian and HEPG2 cells by reducing MMP, DNA damage, and mediating apoptosis.214 In addition, this perturbation also leads to changes in the mitochondrial respiratory chain, dynamics, biogenesis, and autophagy control.215

ZnONPs are used in biomedical imaging and, fungicides and as anticancer drugs and antimicrobial agents.216 The toxicity of these NPs has been mainly related to the production of ROS, which leads to oxidative stress, inflammation, and DNA and protein modifications. The oxidative stress also leads to lipid peroxidation and apoptosis through the p38 and p53 pathways.217 The ROS production also leads to the activation of MAPK pathway, which regulates different cellular pathways.218

In one study, ZnONPs at 1420 g/mL exposed to HEPG2 cells for 12 hours induced apoptosis-mediated reduced cell viability. The cell-viability decline was due to oxidative stressmediated DNA damage and decreased MMP. Furthermore, these NPs increased the ratio of BAX:Bcl2, which led to the induction of apoptotic pathways. ZnONPs also activated p38 and JNK pathways and induced the phosphorylation of p53 Ser15 residues.219

Various investigations support the role of ZnONPs in mitochondria-mediated toxicity induction in experimental animal studies and in vitro models.220 These NPs trigger excessive ROS production in zebrafish embryos by reducing MMP and inducing mitochondria-mediated apoptosis.221 Further, they decrease mitochondrial density by disrupting biogenesis, inhibit the PGC1 pathway, and interfere with mtDNA number control. PGC1 plays a significant role in mitochondrial biogenesis regulation by interaction with downstream targets like TFAM, which helps in transcription of some genes. This factor also plays an important role in controlling mitochondrial oxidative stress by the activation of manganese superoxide dismutase.222

FeONPs have been used for cell labeling, gene delivery, and drug targeting and as hyperthermia-therapy agents. These NPs are also good contrast agents in magnetic resonance imaging.223 FeONPs induce such cellular responses as cell activation, ROS production, and cell death.224 In addition, FeONPs cause mitochondrial damage, though these NPs are not targeted for this organelle.225 Mitochondria are the principal source of ROS generation, and prolonged action initiates oxidative stress, which leads to activation of transcription factors and some inflammation-responsible genes like AP1 and NFKB.

Magnetic composite NPs for dual modal photothermal therapy and photodynamic therapy have been used to enhanced cancer therapeutic effect by mitochondria targeting. These composite NPs have the capacity to generate heat and ROS simultaneously upon NIR-laser irradiation. After surface modification of targeting ligands, they have been selectively delivered to mitochondria to amplify the cancer-cell apoptosis promoted by hyperthermia and cytotoxic ROS.226

Lung cancer cells have been reported to increase their ROS production after exposure to FeONPs. This increased production is blocked by N-acetyl cysteine (NAC), which results in significantly decreased cell death. In addition, this exposure also leads to decreased conversion of LC3-I to LC3-II within cancer cells pretreated with f-NAC. Therefore, FeONPs likely induce ROS production and autophagy-mediated cell death. These lethal consequences are likely due to mitochondrial damage caused by FeONPs, as MMP is significantly reduced as well.227

FeONPs have been probed with P13/Akt, and it was observed that they activated the classical AMPKmTORAkt signaling cascades in lung cancer cells. The involvement of AMPK phosphorylation during autophagic cell death has been fully confirmed by pretreating the cells with the AMPK-phosphorylation inhibitor compound C.228 However, the direct role of FeONPs on AMPK- and mTOR-mediated autophagy and cell death with the help of certain inhibitors is still under observation. It has been observed that FeONPs possess autophagic potential by activating the classical pathway for autophagy induction.229 Some more examples of drug-loaded nanocarriers targeting mitochondria with the aid of varied targeting moieties are briefly listed in Table 3.

Table 3 Drug-loaded nanocarriers tagged with various mitochondriophilic ligands, inducing different mitochondrial functional irregularities

Using native drugs poses a number of challenges before reaching the final target of action. Healthcare researchers are working hard to design the drugs that can be specifically transported to the site of action while minimizing unwanted buildup in untargeted normal tissue. NPs can have different routes of administration like respiratory tract, skin, and parenteral administration to reach the actual target.247 Properties that can give rise to unexpected toxicities should be equally noted.248 In the blood, some drug nanoformulations can lead to the formation of protein corona while in contact with plasma proteins. The protein corona may consist of dozens to hundreds of proteins that can alter the physicochemical properties of NPs like morphology, size, aggregation, and -potential.249

The toxicity potential of cationic NPs like polystyrene and AuNPs can lead to clotting and hemolysis, whereas the toxicity potential of anionic NPs is considerably less.250 NP use leads to some basal toxicities, due to disruption of host homeostasis that leads to ROS production.251 Enhanced ROS can promote genome damage and micronuclei formation. AgNPs of 15 nm and amorphous TiO2 NPs of 30 nm in size induce the highest ROS generation. The possible engulfment of quantum dots and AgNPs by macrophages can lead to the expression of inflammatory mediators like IL1, TNF, MIP2, irrespective of their size.252 The chronic inflammation by ROS producing NPs can lead to the development of pulmonary diseases, atherosclerosis, or even cancer. Other NPs can affect calcium homeostasis, thus affecting cellular metabolism, signal transduction, and gene expression. Dissociated ions from metallic NPs can even prove to be more toxic, so NPs of biodegradable polymers can be beneficial to use.253,254 Single- or multiwalled CNTs induce the aggregation of platelets, while their building-block C60 fullerenes do not. All NPs tend to accumulate in the liver, and the mechanism of their elimination from the body needs to be investigated.247

NPs have been extensively studied in theranostic clinical applications, and several formulations have been approved by the US Food and Drug Administration and European Medicines Agency for clinical applications in patients with cancer.255 The formulation of cancer nanomedicines is mainly based on liposomes (eg, Doxil, Vyxeos, and Onivyde), polymeric micelles (eg, NK105, Genexol, and NC6004), albumin (eg, Abraxane), or inorganic NPs (eg, NBTXR3 and NanoTherm). Although most current cancer nanomedicines are administered intravenously for systemic delivery to tumors, some nanomedicine formulations (eg, NanoTherm and NBTXR3) have been designed for intratumoral administration.256 A brief overview of some major approaches of nanomedicine aiming to modulate the TCA cycle, ETC, anaplerosis, mtROS, and mitochondria-driven apoptosis in cancer cells is presented in Table 4. The table also highlights clinical phase stages and the clinical identifier numbers of molecular targets and the drugs used against these targets.

Table 4 Clinical perspectives (phases and trials) of some Mitochondria-targeted therapeutic strategies for cancer management

The strategy of direct therapeutic action by targeting mitochondria will dramatically decrease the side effects of a particular drug at aspecific locations, and is the ultimate goal of future therapeutics. Nanomedicine faces tremendous challenges due to the diverse nature of biological systems. The advantage of engineering multidimensional features within NPs for specific targeting to diseased cells and enhanced accumulation in particular organelles has drastically revolutionized therapeutic strategies, where mitochondrial dysfunction plays a central role.

NPs like liposomes, micelles, CNTs, and dendrimers tagged with specific mitochondria-targeting moieties have demonstrated their existence as novel delivery means. However, more comprehensive research is necessary to properly understand the safety aspects of drug nanoformulations when used in human subjects. For successful mitochondrial targeting, the characteristics of these theranostic NPs should be highly efficient to achieve their goals. Some novel characteristics include tumor-cell and tissue specificity, long circulation time in blood, and large accumulation within cancer-cell mitochondria.

Some types of currently used mitochondria-targeting nanoformulations suffer from certain drawbacks. For example, delocalized lipophilic cations accumulate efficiently in mitochondria because of negative mitochondrial membrane potential; however, they mediate intrinsic toxicity, which limits their clinical applications. In addition, other targeting ligands like peptides have bulky structures, solubility issues, poor membrane permeability, and very low stability in serum. To overcome these limitations, in-depth research is necessary to engineer such targeting ligands properly to make them clinically more useful as drug-loaded mitochondria-targeting agents.

It is a very challenging task to engineer nanoformulations that can perfectly target mitochondrial abnormalities in tumor cells without toxicity to nearby normal cells. To solve this challenge, different physicochemical factors of nanoformulations have been considered, which include shape, size, charge, membrane potential, tumor-cell specificity, andcombinations thereof.

The endosomal escape ability of theranostic nanoformulations is of utmost importance in enhancing their mitochondria-targeting abilities. For the production of effective mitochondria-targeting NPs, these nanoformulations should be equipped with endosomolytic features. Furthermore, as NIR photosensitizers enable the imaging of NIR fluorescence, photothermal signals, and photoacoustic signals, the corresponding diagnostic materials should be considered for other imaging tools like CT, PET, MRI, and SPECT.

Despite the success of these novel nanoformulations in in vitro studies, thorough and logical preclinical and clinical studies are obligatory to achieve their potential use in clinical settings. At present, there is a big gap in understanding the safety aspects unique to specific nanoformulations when used in varied systems. These of nanoformulations need to be properly addressed when targeting mitochondria of diseased cells only. Enormous efforts are required for the development of targeted nanoformulations. It is extremely difficult to use nanoformulations unless full understanding and characterization of them are achieved.

The direct mitochondria-targeting approach within cancer cells is a current focused to enhance therapeutic strategies, and has gained momentum in the last decade. The goal is to design nanoformulations that can show minimum off-target and side effects. Mitochondria of cancer cells have unique features, which are novel targets of different theranostic NPs as a therapeutic strategy. These novel targets include oxidative phosphorylation site, TCA cycle, glutamine metabolism, and mitochondrial dynamics and trafficking. The direct conjugation of anticancer drugs with mitochondria-targeting ligands (eg, TPP, DQA, and MPP) has been able to solve some complications like use of larger doses and drug resistance. This problem has been solved to some extent by the use of nanoformulations (eg, liposomes, Mito-Porter, and CNTs), but still there are so many other challenges like toxicity complications and center-point targeting that need to be sorted out. Despite the primary success of these nanoformulations, systematic preclinical and clinical investigations are obligatory before their actual use in clinical settings. At present, there is a lack of thorough understanding regarding safety concerns, which limits their use as nanomedicine. The safety aspects of these nanoformulations need to be properly addressed through appropriate safeguards. The prerequisite of thorough understanding of the mitochondrial role in cancer progression, employment of proper regulatory procedures, and advancements in nanoformulation technology will definitely boost cancer treatment in the near future.

We are thankful to all the researchers who have contributed immensely to the field of cancer biology by using mitochondria-specific drug nanoformulations as a strategy in cancer therapy.

The researchers would like to thank the Deanship of Scientific Research, Qassim University for funding the publication of this project.

The authors declare no conflicts of interest.

1. Chan DC. Fusion and fission: interlinked processes critical for mitochondrial health. Annu Rev Genet. 2012;46:265287. doi:10.1146/annurev-genet-110410-132529

2. Hoitzing H, Johnston IG, Jones NS. What is the function of mitochondrial networks? A theoretical assessment of hypotheses and proposal for future research. Bioessays. 2015;37(6):687700. doi:10.1002/bies.201400188

3. Rai PK, Russell OM, Lightowlers RN, Turnbull DM. Potential compounds for the treatment of mitochondrial disease. Br Med Bull. 2015;116:518. doi:10.1093/bmb/ldv046

4. Xia MF, Zhang YZ, Jin K, Lu ZT, Zeng Z, Xiong W. Communication between mitochondria and other organelles: a brandnew perspective on mitochondria in cancer. Cell Biosci. 2019;9:27. doi:10.1186/s13578-019-0289-8

5. Gorman GS, Chinnery PF, DiMauro S, et al. Mitochondrial diseases. Nat Rev Dis Primers. 2016;2(1):122. doi:10.1038/nrdp.2016.80

6. Solaini G, Sgarbi G, Baracca A. Oxidative phosphorylation in cancer cells. Biochim Biophys Acta. 2011;1807(6):534542. doi:10.1016/j.bbabio.2010.09.003

Read more from the original source:
Novel Strategies for Disrupting Cancer-Cell Functions with Mitochondri | IJN - Dove Medical Press

Comments are closed.

Back to Top